SDAD1 polyclonal antibody
  • SDAD1 polyclonal antibody

SDAD1 polyclonal antibody

Ref: AB-PAB22932
SDAD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SDAD1.
Información adicional
Size 100 uL
Gene Name SDAD1
Gene Alias DKFZp686E22207|FLJ10498
Gene Description SDA1 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VGINAIKEITARCPLAMTEELLQDLAQYKTHKDKNVMMSARTLIHLFRTLNPQMLQKKFRGKPTEASIEARVQEYGEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SDAD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55153
Iso type IgG

Enviar un mensaje


SDAD1 polyclonal antibody

SDAD1 polyclonal antibody