ZSWIM6 polyclonal antibody
  • ZSWIM6 polyclonal antibody

ZSWIM6 polyclonal antibody

Ref: AB-PAB22929
ZSWIM6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZSWIM6.
Información adicional
Size 100 uL
Gene Name ZSWIM6
Gene Alias DKFZp779P0344|KIAA1577
Gene Description zinc finger, SWIM-type containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DPVGTLFSSLMEACRIDDENLSGFSDFTENMGQCKSLEYQHLPAHKFLEEGESYLTLAVEVAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZSWIM6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57688
Iso type IgG

Enviar un mensaje


ZSWIM6 polyclonal antibody

ZSWIM6 polyclonal antibody