MED28 polyclonal antibody
  • MED28 polyclonal antibody

MED28 polyclonal antibody

Ref: AB-PAB22921
MED28 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MED28.
Información adicional
Size 100 uL
Gene Name MED28
Gene Alias 1500003D12Rik|DKFZp434N185|EG1|magicin
Gene Description mediator complex subunit 28
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MED28.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80306
Iso type IgG

Enviar un mensaje


MED28 polyclonal antibody

MED28 polyclonal antibody