SIDT1 polyclonal antibody
  • SIDT1 polyclonal antibody

SIDT1 polyclonal antibody

Ref: AB-PAB22918
SIDT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SIDT1.
Información adicional
Size 100 uL
Gene Name SIDT1
Gene Alias B830021E24Rik|FLJ20174|SID-1|SID1
Gene Description SID1 transmembrane family, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFGSNDGSGNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SIDT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54847
Iso type IgG

Enviar un mensaje


SIDT1 polyclonal antibody

SIDT1 polyclonal antibody