GCC2 polyclonal antibody
  • GCC2 polyclonal antibody

GCC2 polyclonal antibody

Ref: AB-PAB22917
GCC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GCC2.
Información adicional
Size 100 uL
Gene Name GCC2
Gene Alias GCC185|KIAA0336
Gene Description GRIP and coiled-coil domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QNISEANSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELENLRKATSNANQDNQICSIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GCC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9648
Iso type IgG

Enviar un mensaje


GCC2 polyclonal antibody

GCC2 polyclonal antibody