NOA1 polyclonal antibody
  • NOA1 polyclonal antibody

NOA1 polyclonal antibody

Ref: AB-PAB22916
NOA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NOA1.
Información adicional
Size 100 uL
Gene Name NOA1
Gene Alias C4orf14|hAtNOS1|hNOA1|mAtNOS1
Gene Description nitric oxide associated 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LVAEDIMLKEGLGASEAVADIKFSSAGWVSVTPNFKDRLHLRGYTPEGTVLTVRPPLLPYIVNIKGQRIKKSVAYKTKKPPSLMYNVRKKKGKIN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NOA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84273
Iso type IgG

Enviar un mensaje


NOA1 polyclonal antibody

NOA1 polyclonal antibody