PPP2R3A polyclonal antibody
  • PPP2R3A polyclonal antibody

PPP2R3A polyclonal antibody

Ref: AB-PAB22913
PPP2R3A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP2R3A.
Información adicional
Size 100 uL
Gene Name PPP2R3A
Gene Alias PPP2R3|PR130|PR72
Gene Description protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP2R3A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5523
Iso type IgG

Enviar un mensaje


PPP2R3A polyclonal antibody

PPP2R3A polyclonal antibody