CLEC16A polyclonal antibody
  • CLEC16A polyclonal antibody

CLEC16A polyclonal antibody

Ref: AB-PAB22910
CLEC16A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLEC16A.
Información adicional
Size 100 uL
Gene Name CLEC16A
Gene Alias Gop-1|KIAA0350|MGC111457
Gene Description C-type lectin domain family 16, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PMSPELPKPHLPDQLVIVNETEADSKPSKNVARSAAVETASLSPSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRSLTGMPPLSTPAAACTEPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLEC16A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23274
Iso type IgG

Enviar un mensaje


CLEC16A polyclonal antibody

CLEC16A polyclonal antibody