LRRC34 polyclonal antibody
  • LRRC34 polyclonal antibody

LRRC34 polyclonal antibody

Ref: AB-PAB22905
LRRC34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC34.
Información adicional
Size 100 uL
Gene Name LRRC34
Gene Alias FLJ27346|MGC27085
Gene Description leucine rich repeat containing 34
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC34.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 151827
Iso type IgG

Enviar un mensaje


LRRC34 polyclonal antibody

LRRC34 polyclonal antibody