SERINC1 polyclonal antibody
  • SERINC1 polyclonal antibody

SERINC1 polyclonal antibody

Ref: AB-PAB22902
SERINC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SERINC1.
Información adicional
Size 100 uL
Gene Name SERINC1
Gene Alias KIAA1253|TDE1L|TDE2|TMS-2
Gene Description serine incorporator 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SERINC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57515
Iso type IgG

Enviar un mensaje


SERINC1 polyclonal antibody

SERINC1 polyclonal antibody