IWS1 polyclonal antibody
  • IWS1 polyclonal antibody

IWS1 polyclonal antibody

Ref: AB-PAB22898
IWS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IWS1.
Información adicional
Size 100 uL
Gene Name IWS1
Gene Alias DKFZp761G0123|FLJ10006|FLJ14655|FLJ32319|MGC126375|MGC126376
Gene Description IWS1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IFGESGDEEEEEFTGFNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IWS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55677
Iso type IgG

Enviar un mensaje


IWS1 polyclonal antibody

IWS1 polyclonal antibody