CLNK polyclonal antibody
  • CLNK polyclonal antibody

CLNK polyclonal antibody

Ref: AB-PAB22892
CLNK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLNK.
Información adicional
Size 100 uL
Gene Name CLNK
Gene Alias MGC35197|MIST
Gene Description cytokine-dependent hematopoietic cell linker
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLNK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116449
Iso type IgG

Enviar un mensaje


CLNK polyclonal antibody

CLNK polyclonal antibody