TMEM132B polyclonal antibody
  • TMEM132B polyclonal antibody

TMEM132B polyclonal antibody

Ref: AB-PAB22891
TMEM132B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM132B.
Información adicional
Size 100 uL
Gene Name TMEM132B
Gene Alias KIAA1786|KIAA1906
Gene Description transmembrane protein 132B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSLTSSSVADQFTLRIKAAAGVKITAVRVSSEDQWAVQEEIDNGSTQTSATLTCMGHRPDTQSRVNGSFYEILQVDFGID
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM132B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114795
Iso type IgG

Enviar un mensaje


TMEM132B polyclonal antibody

TMEM132B polyclonal antibody