LBA1 polyclonal antibody
  • LBA1 polyclonal antibody

LBA1 polyclonal antibody

Ref: AB-PAB22882
LBA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LBA1.
Información adicional
Size 100 uL
Gene Name LBA1
Gene Alias KIAA0342
Gene Description lupus brain antigen 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CKLADSIKAICNAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEKGREHVNPEYFPPASAVETEYNIMKFHSFST
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LBA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9881
Iso type IgG

Enviar un mensaje


LBA1 polyclonal antibody

LBA1 polyclonal antibody