C6orf91 polyclonal antibody
  • C6orf91 polyclonal antibody

C6orf91 polyclonal antibody

Ref: AB-PAB22879
C6orf91 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf91.
Información adicional
Size 100 uL
Gene Name C6orf91
Gene Alias LFDH|dJ509I19.2|dJ509I19.3
Gene Description chromosome 6 open reading frame 91
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf91.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 345930
Iso type IgG

Enviar un mensaje


C6orf91 polyclonal antibody

C6orf91 polyclonal antibody