ANKRD35 polyclonal antibody
  • ANKRD35 polyclonal antibody

ANKRD35 polyclonal antibody

Ref: AB-PAB22876
ANKRD35 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD35.
Información adicional
Size 100 uL
Gene Name ANKRD35
Gene Alias FLJ25124|MGC126667|MGC126669
Gene Description ankyrin repeat domain 35
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLREELAAVWREKDAARGALSRPVMEGALGTPRAEAAAAAWEKMEARLERVLARLEWAKAGLQVKPEVPSQESREGALKAAPGSIKQDEEKEKRVPGA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD35.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 148741
Iso type IgG

Enviar un mensaje


ANKRD35 polyclonal antibody

ANKRD35 polyclonal antibody