NPPC polyclonal antibody
  • NPPC polyclonal antibody

NPPC polyclonal antibody

Ref: AB-PAB22868
NPPC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NPPC.
Información adicional
Size 100 uL
Gene Name NPPC
Gene Alias CNP
Gene Description natriuretic peptide precursor C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NPPC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4880
Iso type IgG

Enviar un mensaje


NPPC polyclonal antibody

NPPC polyclonal antibody