ECM2 polyclonal antibody
  • ECM2 polyclonal antibody

ECM2 polyclonal antibody

Ref: AB-PAB22867
ECM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ECM2.
Información adicional
Size 100 uL
Gene Name ECM2
Gene Alias MGC126355|MGC126356
Gene Description extracellular matrix protein 2, female organ and adipocyte specific
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ECM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1842
Iso type IgG

Enviar un mensaje


ECM2 polyclonal antibody

ECM2 polyclonal antibody