SLC1A5 polyclonal antibody
  • SLC1A5 polyclonal antibody

SLC1A5 polyclonal antibody

Ref: AB-PAB22862
SLC1A5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC1A5.
Información adicional
Size 100 uL
Gene Name SLC1A5
Gene Alias AAAT|ASCT2|ATBO|FLJ31068|M7V1|M7VS1|R16|RDRC
Gene Description solute carrier family 1 (neutral amino acid transporter), member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC1A5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6510
Iso type IgG

Enviar un mensaje


SLC1A5 polyclonal antibody

SLC1A5 polyclonal antibody