MAST3 polyclonal antibody
  • MAST3 polyclonal antibody

MAST3 polyclonal antibody

Ref: AB-PAB22847
MAST3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAST3.
Información adicional
Size 100 uL
Gene Name MAST3
Gene Alias KIAA0561
Gene Description microtubule associated serine/threonine kinase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPTFAERSFSEDREEGWERSEVDYGRRLSADIRLRSWTSSGSSCQSSSSQPERGPSPSLLNTISLDTMPKFA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAST3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23031
Iso type IgG

Enviar un mensaje


MAST3 polyclonal antibody

MAST3 polyclonal antibody