OPTC polyclonal antibody
  • OPTC polyclonal antibody

OPTC polyclonal antibody

Ref: AB-PAB22838
OPTC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OPTC.
Información adicional
Size 100 uL
Gene Name OPTC
Gene Alias OPT
Gene Description opticin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNLLDSIP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OPTC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26254
Iso type IgG

Enviar un mensaje


OPTC polyclonal antibody

OPTC polyclonal antibody