ZFAND6 polyclonal antibody
  • ZFAND6 polyclonal antibody

ZFAND6 polyclonal antibody

Ref: AB-PAB22836
ZFAND6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZFAND6.
Información adicional
Size 100 uL
Gene Name ZFAND6
Gene Alias AWP1|ZA20D3|ZFAND5B
Gene Description zinc finger, AN1-type domain 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZFAND6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54469
Iso type IgG

Enviar un mensaje


ZFAND6 polyclonal antibody

ZFAND6 polyclonal antibody