LIPT1 polyclonal antibody
  • LIPT1 polyclonal antibody

LIPT1 polyclonal antibody

Ref: AB-PAB22829
LIPT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LIPT1.
Información adicional
Size 100 uL
Gene Name LIPT1
Gene Alias MGC12290|MGC13378
Gene Description lipoyltransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCEVLMNAVATEYAAYHQIDNHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LIPT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51601
Iso type IgG

Enviar un mensaje


LIPT1 polyclonal antibody

LIPT1 polyclonal antibody