NCRNA00082 polyclonal antibody
  • NCRNA00082 polyclonal antibody

NCRNA00082 polyclonal antibody

Ref: AB-PAB22828
NCRNA00082 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NCRNA00082.
Información adicional
Size 100 uL
Gene Name NCRNA00082
Gene Alias MGC33556|p40
Gene Description non-protein coding RNA 82
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NCRNA00082.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339541
Iso type IgG

Enviar un mensaje


NCRNA00082 polyclonal antibody

NCRNA00082 polyclonal antibody