BSN polyclonal antibody
  • BSN polyclonal antibody

BSN polyclonal antibody

Ref: AB-PAB22825
BSN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BSN.
Información adicional
Size 100 uL
Gene Name BSN
Gene Alias ZNF231
Gene Description bassoon (presynaptic cytomatrix protein)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AQEHTFLATATTVSITMASSVFMAQQKQPVVYGDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BSN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8927
Iso type IgG

Enviar un mensaje


BSN polyclonal antibody

BSN polyclonal antibody