KIF4A polyclonal antibody
  • KIF4A polyclonal antibody

KIF4A polyclonal antibody

Ref: AB-PAB22822
KIF4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF4A.
Información adicional
Size 100 uL
Gene Name KIF4A
Gene Alias FLJ12530|FLJ12655|FLJ14204|FLJ20631|HSA271784|KIF4|KIF4-G1
Gene Description kinesin family member 4A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SDETVACMAAAIDTAVEQEAQVETSPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALARKMTQNDSQLQPIQYQYQDN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 24137
Iso type IgG

Enviar un mensaje


KIF4A polyclonal antibody

KIF4A polyclonal antibody