DNAH7 polyclonal antibody
  • DNAH7 polyclonal antibody

DNAH7 polyclonal antibody

Ref: AB-PAB22820
DNAH7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAH7.
Información adicional
Size 100 uL
Gene Name DNAH7
Gene Alias DKFZp686C09101|FLJ37196|KIAA0944|MGC39580
Gene Description dynein, axonemal, heavy chain 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAH7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56171
Iso type IgG

Enviar un mensaje


DNAH7 polyclonal antibody

DNAH7 polyclonal antibody