FAM82A1 polyclonal antibody
  • FAM82A1 polyclonal antibody

FAM82A1 polyclonal antibody

Ref: AB-PAB22817
FAM82A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM82A1.
Información adicional
Size 100 uL
Gene Name FAM82A1
Gene Alias BLOCK18|FAM82A|FLJ32954|FLJ38143|MGC33318|PRO34163|PYST9371|RMD2|hRMD-2|hRMD-4
Gene Description family with sequence similarity 82, member A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM82A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 151393
Iso type IgG

Enviar un mensaje


FAM82A1 polyclonal antibody

FAM82A1 polyclonal antibody