CHCHD4 polyclonal antibody
  • CHCHD4 polyclonal antibody

CHCHD4 polyclonal antibody

Ref: AB-PAB22814
CHCHD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHCHD4.
Información adicional
Size 100 uL
Gene Name CHCHD4
Gene Alias FLJ31709|MIA40
Gene Description coiled-coil-helix-coiled-coil-helix domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHCHD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 131474
Iso type IgG

Enviar un mensaje


CHCHD4 polyclonal antibody

CHCHD4 polyclonal antibody