NAP5 polyclonal antibody
  • NAP5 polyclonal antibody

NAP5 polyclonal antibody

Ref: AB-PAB22809
NAP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAP5.
Información adicional
Size 100 uL
Gene Name NAP5
Gene Alias ERIH2|FLJ34870
Gene Description Nck-associated protein 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 344148
Iso type IgG

Enviar un mensaje


NAP5 polyclonal antibody

NAP5 polyclonal antibody