PKDREJ polyclonal antibody
  • PKDREJ polyclonal antibody

PKDREJ polyclonal antibody

Ref: AB-PAB22806
PKDREJ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PKDREJ.
Información adicional
Size 100 uL
Gene Name PKDREJ
Gene Alias -
Gene Description polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QPVYEEPSDEVEAMTYLCRKLRTMFSFLTSQSKAKDEPEFFIDMLYGQPEKNSHRYLGLKTRNINGKKMVYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PKDREJ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10343
Iso type IgG

Enviar un mensaje


PKDREJ polyclonal antibody

PKDREJ polyclonal antibody