MAPK1IP1L polyclonal antibody
  • MAPK1IP1L polyclonal antibody

MAPK1IP1L polyclonal antibody

Ref: AB-PAB22804
MAPK1IP1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAPK1IP1L.
Información adicional
Size 100 uL
Gene Name MAPK1IP1L
Gene Alias C14orf32|MGC23138|MISS|c14_5346
Gene Description mitogen-activated protein kinase 1 interacting protein 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAPK1IP1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93487
Iso type IgG

Enviar un mensaje


MAPK1IP1L polyclonal antibody

MAPK1IP1L polyclonal antibody