KIF17 polyclonal antibody
  • KIF17 polyclonal antibody

KIF17 polyclonal antibody

Ref: AB-PAB22793
KIF17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF17.
Información adicional
Size 100 uL
Gene Name KIF17
Gene Alias KIAA1405|KIF17B|KIF3X
Gene Description kinesin family member 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57576
Iso type IgG

Enviar un mensaje


KIF17 polyclonal antibody

KIF17 polyclonal antibody