MMGT1 polyclonal antibody
  • MMGT1 polyclonal antibody

MMGT1 polyclonal antibody

Ref: AB-PAB22790
MMGT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MMGT1.
Información adicional
Size 100 uL
Gene Name MMGT1
Gene Alias TMEM32
Gene Description membrane magnesium transporter 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MMGT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93380
Iso type IgG

Enviar un mensaje


MMGT1 polyclonal antibody

MMGT1 polyclonal antibody