KPRP polyclonal antibody
  • KPRP polyclonal antibody

KPRP polyclonal antibody

Ref: AB-PAB22789
KPRP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KPRP.
Información adicional
Size 100 uL
Gene Name KPRP
Gene Alias C1orf45
Gene Description keratinocyte proline-rich protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KPRP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 448834
Iso type IgG

Enviar un mensaje


KPRP polyclonal antibody

KPRP polyclonal antibody