NALCN polyclonal antibody
  • NALCN polyclonal antibody

NALCN polyclonal antibody

Ref: AB-PAB22788
NALCN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NALCN.
Información adicional
Size 100 uL
Gene Name NALCN
Gene Alias CanIon|FLJ23913|FLJ44659|FLJ44764|MGC74524|VGCNL1|bA430M15.1
Gene Description sodium leak channel, non-selective
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPISHSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NALCN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 259232
Iso type IgG

Enviar un mensaje


NALCN polyclonal antibody

NALCN polyclonal antibody