BCORL1 polyclonal antibody
  • BCORL1 polyclonal antibody

BCORL1 polyclonal antibody

Ref: AB-PAB22786
BCORL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCORL1.
Información adicional
Size 100 uL
Gene Name BCORL1
Gene Alias B930011H20Rik|CXorf10|FLJ11362|FLJ11632
Gene Description BCL6 co-repressor-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BCORL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63035
Iso type IgG

Enviar un mensaje


BCORL1 polyclonal antibody

BCORL1 polyclonal antibody