TTBK1 polyclonal antibody
  • TTBK1 polyclonal antibody

TTBK1 polyclonal antibody

Ref: AB-PAB22784
TTBK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTBK1.
Información adicional
Size 100 uL
Gene Name TTBK1
Gene Alias BDTK|KIAA1855|RP3-330M21.4
Gene Description tau tubulin kinase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTBK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84630
Iso type IgG

Enviar un mensaje


TTBK1 polyclonal antibody

TTBK1 polyclonal antibody