SLC7A4 polyclonal antibody
  • SLC7A4 polyclonal antibody

SLC7A4 polyclonal antibody

Ref: AB-PAB22772
SLC7A4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC7A4.
Información adicional
Size 100 uL
Gene Name SLC7A4
Gene Alias CAT-4|CAT4|HCAT3|MGC129976|MGC129977|VH
Gene Description solute carrier family 7 (cationic amino acid transporter, y+ system), member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC7A4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6545
Iso type IgG

Enviar un mensaje


SLC7A4 polyclonal antibody

SLC7A4 polyclonal antibody