TACC2 polyclonal antibody
  • TACC2 polyclonal antibody

TACC2 polyclonal antibody

Ref: AB-PAB22771
TACC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TACC2.
Información adicional
Size 100 uL
Gene Name TACC2
Gene Alias AZU-1|ECTACC
Gene Description transforming, acidic coiled-coil containing protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLPTHGGQEQALGSELQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TACC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10579
Iso type IgG

Enviar un mensaje


TACC2 polyclonal antibody

TACC2 polyclonal antibody