MDFIC polyclonal antibody
  • MDFIC polyclonal antibody

MDFIC polyclonal antibody

Ref: AB-PAB22762
MDFIC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MDFIC.
Información adicional
Size 100 uL
Gene Name MDFIC
Gene Alias HIC
Gene Description MyoD family inhibitor domain containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QDQSIWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MDFIC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29969
Iso type IgG

Enviar un mensaje


MDFIC polyclonal antibody

MDFIC polyclonal antibody