SYNPO2 polyclonal antibody
  • SYNPO2 polyclonal antibody

SYNPO2 polyclonal antibody

Ref: AB-PAB22759
SYNPO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYNPO2.
Información adicional
Size 100 uL
Gene Name SYNPO2
Gene Alias DKFZp686G051
Gene Description synaptopodin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGASETANIQRMVPMNRTAKPFPGSVNQPAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYNPO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 171024
Iso type IgG

Enviar un mensaje


SYNPO2 polyclonal antibody

SYNPO2 polyclonal antibody