ZNF711 polyclonal antibody
  • ZNF711 polyclonal antibody

ZNF711 polyclonal antibody

Ref: AB-PAB22758
ZNF711 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF711.
Información adicional
Size 100 uL
Gene Name ZNF711
Gene Alias CMPX1|ZNF4|ZNF5|ZNF6|Zfp711|dJ75N13.1
Gene Description zinc finger protein 711
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVTGPNGHLEHVVQDCVSGVDSPTMVSEEVLVTN
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF711.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7552
Iso type IgG

Enviar un mensaje


ZNF711 polyclonal antibody

ZNF711 polyclonal antibody