IBA57 polyclonal antibody
  • IBA57 polyclonal antibody

IBA57 polyclonal antibody

Ref: AB-PAB22757
IBA57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IBA57.
Información adicional
Size 100 uL
Gene Name IBA57
Gene Alias RP11-520H14.5|C1orf69
Gene Description IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WRLLTQDEGPALVPGGRLGDLWDYHQHRYLQGVPEGVRDLPPGVALPLESNLAFMNGVSFTKGCYIGQELTARTHHMGVIRKRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IBA57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200205
Iso type IgG

Enviar un mensaje


IBA57 polyclonal antibody

IBA57 polyclonal antibody