TYSND1 polyclonal antibody
  • TYSND1 polyclonal antibody

TYSND1 polyclonal antibody

Ref: AB-PAB22755
TYSND1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TYSND1.
Información adicional
Size 100 uL
Gene Name TYSND1
Gene Alias FLJ40378|MGC131934|MGC34695
Gene Description trypsin domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ATQETCPYDIAVVSLEEDLDDVPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TYSND1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219743
Iso type IgG

Enviar un mensaje


TYSND1 polyclonal antibody

TYSND1 polyclonal antibody