RAB11FIP3 polyclonal antibody
  • RAB11FIP3 polyclonal antibody

RAB11FIP3 polyclonal antibody

Ref: AB-PAB22750
RAB11FIP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB11FIP3.
Información adicional
Size 100 uL
Gene Name RAB11FIP3
Gene Alias KIAA0665|Rab11-FIP3
Gene Description RAB11 family interacting protein 3 (class II)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB11FIP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9727
Iso type IgG

Enviar un mensaje


RAB11FIP3 polyclonal antibody

RAB11FIP3 polyclonal antibody