PLXNA4 polyclonal antibody
  • PLXNA4 polyclonal antibody

PLXNA4 polyclonal antibody

Ref: AB-PAB22749
PLXNA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLXNA4.
Información adicional
Size 100 uL
Gene Name PLXNA4
Gene Alias DKFZp434G0625|DKFZp566O0546|FAYV2820|FLJ35026|FLJ38287|KIAA1550|PLEXA4|PLXNA4A|PLXNA4B|PRO34003
Gene Description plexin A4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLXNA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91584
Iso type IgG

Enviar un mensaje


PLXNA4 polyclonal antibody

PLXNA4 polyclonal antibody