KPNB1 polyclonal antibody
  • KPNB1 polyclonal antibody

KPNB1 polyclonal antibody

Ref: AB-PAB22748
KPNB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KPNB1.
Información adicional
Size 100 uL
Gene Name KPNB1
Gene Alias IMB1|IPO1|IPOB|Impnb|MGC2155|MGC2156|MGC2157|NTF97
Gene Description karyopherin (importin) beta 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KPNB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3837
Iso type IgG

Enviar un mensaje


KPNB1 polyclonal antibody

KPNB1 polyclonal antibody