KPNB1 polyclonal antibody Ver mas grande

KPNB1 polyclonal antibody

AB-PAB22748

Producto nuevo

KPNB1 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name KPNB1
Gene Alias IMB1|IPO1|IPOB|Impnb|MGC2155|MGC2156|MGC2157|NTF97
Gene Description karyopherin (importin) beta 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KPNB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3837
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant KPNB1.

Consulta sobre un producto

KPNB1 polyclonal antibody

KPNB1 polyclonal antibody