CCDC17 polyclonal antibody
  • CCDC17 polyclonal antibody

CCDC17 polyclonal antibody

Ref: AB-PAB22737
CCDC17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC17.
Información adicional
Size 100 uL
Gene Name CCDC17
Gene Alias FLJ17921|FLJ33084
Gene Description coiled-coil domain containing 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq REAELYSPVQKANPGTLAAEIRALREAYIRDGGRDPGVLGQIWQLQVEASALELQRSQTRRGRAGATSGELPVVEAENRRLEAEILALQMQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149483
Iso type IgG

Enviar un mensaje


CCDC17 polyclonal antibody

CCDC17 polyclonal antibody