ZNF226 polyclonal antibody
  • ZNF226 polyclonal antibody

ZNF226 polyclonal antibody

Ref: AB-PAB22731
ZNF226 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF226.
Información adicional
Size 100 uL
Gene Name ZNF226
Gene Alias -
Gene Description zinc finger protein 226
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq LYRDVMVENFRNLLSVGHPPFKQDVSPIERNEQLWIMTTATRRQGNLGEKNQSKLITVQDRESEEELSCWQIWQQIANDLTRCQDSMINNSQCHKQGDFPYQVGTELSIQISEDENYIVNKADGPNNT
Form Liquid
Recomended Dilution Immunofluorescence (0.25-2 ug/mL)
Immunohistochemistry (1:500-1:1000)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF226.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7769
Iso type IgG

Enviar un mensaje


ZNF226 polyclonal antibody

ZNF226 polyclonal antibody